Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6X3
Confidence4.29%DateThu Jan 5 11:04:09 GMT 2012
Rank84Aligned Residues21
% Identity43%Templatec3kf8C_
PDB info PDB header:structural proteinChain: C: PDB Molecule:protein stn1; PDBTitle: crystal structure of c. tropicalis stn1-ten1 complex
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40 .....
Predicted Secondary structure 


...........
Query SS confidence 















. . . . . . . . . . .




Query Sequence  YLVNGIKLQGQIESFD. . . . . . . . . . . QFVIL
Query Conservation 







 
 
  

........... 



Alig confidence 















...........




Template Conservation   

  
 
 
 

    
            

Template Sequence  YPVNQINIFGKIVYEQYKEKEFNGVEESYVIL
Template Known Secondary structure 


BTTB

Template Predicted Secondary structure 












Template SS confidence 































   80.........90.........100.........110.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions