Return to main results Retrieve Phyre Job Id

Job DescriptionP76483
Confidence3.32%DateThu Jan 5 12:23:26 GMT 2012
Rank79Aligned Residues34
% Identity18%Templated1r2aa_
SCOP infoDimerization-anchoring domain of cAMP-dependent PK regulatory subunit Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   104.....110.........120.........130.........140.........
Predicted Secondary structure 















Query SS confidence 













































Query Sequence  DRNELRKQFSIKRLNEMEIYPGVTFSEELEGQLFASIMLDMEKLIS
Query Conservation      
    
        


         
   
 
   
  
  
Alig confidence 

















............















Template Conservation   
  


  





 

............ 

  


 

  
  
Template Sequence  GLTELLQGYTVEVLRQQP. . . . . . . . . . . . PDLVDFAVEYFTRLRE
Template Known Secondary structure  TT

............S
Template Predicted Secondary structure 


............
Template SS confidence 













































   10.........20....... ..30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions