Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFZ7
Confidence1.23%DateThu Jan 5 11:27:41 GMT 2012
Rank88Aligned Residues27
% Identity37%Templatec1x4qA_
PDB info PDB header:rna binding proteinChain: A: PDB Molecule:u4/u6 small nuclear ribonucleoprotein prp3; PDBTitle: solution structure of pwi domain in u4/u6 small nuclear2 ribonucleoprotein prp3(hprp3)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   154.....160.........170.........180......
Predicted Secondary structure 









Query SS confidence 
































Query Sequence  GVGGMQLYRAEMPGPLKDNKMRPRIAETAKTLW
Query Conservation        
   
                    
 
Alig confidence 











......














Template Conservation      







......




 

 

 
 
Template Sequence  GSSGMALSKREL. . . . . . DELKPWIEKTVKRVL
Template Known Secondary structure 
SS




......
Template Predicted Secondary structure 







......
Template SS confidence 
































   4.....10..... ....20.........30
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions