Return to main results Retrieve Phyre Job Id

Job DescriptionP77265
Confidence95.08%DateThu Jan 5 12:26:59 GMT 2012
Rank168Aligned Residues48
% Identity27%Templatec2gesA_
PDB info PDB header:transferaseChain: A: PDB Molecule:pantothenate kinase; PDBTitle: pantothenate kinase from mycobacterium tuberculosis (mtpank) in2 complex with a coenzyme a derivative, form-i (rt)
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   364.....370.........380.........390.........400.........410.........420........
Predicted Secondary structure 




































Query SS confidence 
































































Query Sequence  MLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIPLTKLQLDSWRSRLAVVSQTPFLFSDTVAN
Query Conservation     
 
 








 

 
      
 
      
           
  
 
   
   

 
Alig confidence 






























.................
















Template Conservation 





 






 
  
   
        .................
  

 
 
        
Template Sequence  IIGVAGSVAVGKSTTARVLQALLARWDHHPR. . . . . . . . . . . . . . . . . VDLVTTDGFLYPNAELQ
Template Known Secondary structure 
TTSSSSTT


.................GGGGB

Template Predicted Secondary structure 












.................






Template SS confidence 
































































   92.......100.........110.........120.. .......130.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions