Return to main results Retrieve Phyre Job Id

Job DescriptionP07762
Confidence86.27%DateThu Jan 5 11:00:31 GMT 2012
Rank328Aligned Residues53
% Identity11%Templated1jz8a5
SCOP infoTIM beta/alpha-barrel (Trans)glycosidases beta-glycanases
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   257..260.........270.........280.........290.........300.........310.........320.........330......
Predicted Secondary structure 











































Query SS confidence 















































































Query Sequence  TDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGSWGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDW
Query Conservation        


      

 







 
 



 
 
    



   
 
    


  


 


 

  

 




Alig confidence 















.












...........





...............

















Template Conservation     
     
    

. 


  
 
 

 ........... 
 
  ...............  

   

 



  
 
Template Sequence  PLHGQVMDEQTMVQDI. LLMKQNNFNAVRC. . . . . . . . . . . SHYPNH. . . . . . . . . . . . . . . PLWYTLCDRYGLYVVDEA
Template Known Secondary structure  TTTBT


.TT


...........TTS


...............T

Template Predicted Secondary structure 







.



...........




...............




Template SS confidence 















































































   361........370...... ...380......... 390..... ....400.........410...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions