Return to main results Retrieve Phyre Job Id

Job DescriptionP07762
Confidence70.12%DateThu Jan 5 11:00:31 GMT 2012
Rank446Aligned Residues44
% Identity18%Templatec3muxB_
PDB info PDB header:lyaseChain: B: PDB Molecule:putative 4-hydroxy-2-oxoglutarate aldolase; PDBTitle: the crystal structure of a putative 4-hydroxy-2-oxoglutarate aldolase2 from bacillus anthracis to 1.45a
Resolution1.45 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   269270.........280.........290.........300.........310.........320.........330..
Predicted Secondary structure 


































Query SS confidence 































































Query Sequence  ADQLVPYAKWMGFTHLELLPINEHPFDGSWGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNV
Query Conservation     

 







 
 



 
 
    



   
 
    


  


 


 

  

 
Alig confidence 




















........

............




















Template Conservation 




 
  
 
  



 

........ 
............
  



 


 


  
  
Template Sequence  IKTAIALVRDXGGNSLKYFPX. . . . . . . . KG. . . . . . . . . . . . LAHEEEYRAVAKACAEEGFAL
Template Known Secondary structure  T




........TT............TTTT
Template Predicted Secondary structure 





........

............




Template SS confidence 































































   146...150.........160...... .. .170.........180.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions