Return to main results Retrieve Phyre Job Id

Job DescriptionP07762
Confidence67.03%DateThu Jan 5 11:00:31 GMT 2012
Rank476Aligned Residues44
% Identity16%Templatec3m0zD_
PDB info PDB header:lyaseChain: D: PDB Molecule:putative aldolase; PDBTitle: crystal structure of putative aldolase from klebsiella2 pneumoniae.
Resolution1.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   269270.........280.........290.........300.........310.........320.........330..
Predicted Secondary structure 


































Query SS confidence 































































Query Sequence  ADQLVPYAKWMGFTHLELLPINEHPFDGSWGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNV
Query Conservation     

 







 
 



 
 
    



   
 
    


  


 


 

  

 
Alig confidence 




















....................






















Template Conservation   
 
 

  
 
  



 

.................... 
 
 
 

   




  

 
Template Sequence  LETAIALLKDXGGSSIKYFPX. . . . . . . . . . . . . . . . . . . . GGLKHRAEFEAVAKACAAHDFWL
Template Known Secondary structure  TT




....................TTTTTTT
Template Predicted Secondary structure 






....................




Template SS confidence 































































   144.....150.........160.... .....170.........180.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions