Return to main results Retrieve Phyre Job Id

Job DescriptionP07762
Confidence67.86%DateThu Jan 5 11:00:31 GMT 2012
Rank466Aligned Residues58
% Identity24%Templatec2z1sA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:beta-glucosidase b; PDBTitle: beta-glucosidase b from paenibacillus polymyxa complexed2 with cellotetraose
Resolution2.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   315....320.........330.........340.........350.........360.........370.........380.........390....
Predicted Secondary structure 










































Query SS confidence 















































































Query Sequence  RDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHSDPREGYHQDWNTLIYNYGRREVSNFLVGNALYWI
Query Conservation    


 


 

  

 





 

           

   
            

    
     

  
 
   


Alig confidence 






















..




.







.......................

















Template Conservation 
  
   

 
   

 




 ..


 
.  
   

.......................
     
  
  

  
 
Template Sequence  LLFYEHLLDEIELAGLIPMLTLY. . HWDLP. QWIEDEGG. . . . . . . . . . . . . . . . . . . . . . . WTQRETIQHFKTYASVIM
Template Known Secondary structure  T
..SS

B.TTG.......................GGST
Template Predicted Secondary structure 



..




.


.......................


Template SS confidence 















































































   99100.........110.........120. ..... ...130.... .....140.........150..
 
   395...
Predicted Secondary structure 

Query SS confidence 



Query Sequence  ERFG
Query Conservation   


Alig confidence 



Template Conservation    
 
Template Sequence  DRFG
Template Known Secondary structure  SS
Template Predicted Secondary structure 
Template SS confidence 



   153...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions