Return to main results Retrieve Phyre Job Id

Job DescriptionP07762
Confidence95.22%DateThu Jan 5 11:00:31 GMT 2012
Rank243Aligned Residues50
% Identity20%Templatec2p0oA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:hypothetical protein duf871; PDBTitle: crystal structure of a conserved protein from locus ef_2437 in2 enterococcus faecalis with an unknown function
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   316...320.........330.........340.........350.........360.........370.........380.........390.....
Predicted Secondary structure 










































Query SS confidence 















































































Query Sequence  DDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHSDPREGYHQDWNTLIYNYGRREVSNFLVGNALYWIE
Query Conservation   


 


 

  

 





 

           

   
            

    
     

  
 
   


 
Alig confidence 





































........................................

Template Conservation       
   
      

 



  
  

 
  

  ........................................
 
Template Sequence  QRLTDLGAIAKAEKXKIXVDISGEALKRAGFSFDELEP. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LI
Template Known Secondary structure  T

TTT
BTTB
........................................
Template Predicted Secondary structure 








........................................
Template SS confidence 















































































   47..50.........60.........70.........80.... ..
 
   396...400.....
Predicted Secondary structure 




Query SS confidence 









Query Sequence  RFGIDALRVD
Query Conservation 







 
Alig confidence 









Template Conservation   


  



Template Sequence  ELGVTGLRXD
Template Known Secondary structure  T


Template Predicted Secondary structure 




Template SS confidence 









   87..90......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions