Return to main results Retrieve Phyre Job Id

Job DescriptionP23522
Confidence75.99%DateWed Jan 25 15:20:43 GMT 2012
Rank197Aligned Residues36
% Identity28%Templatec2dp3A_
PDB info PDB header:isomeraseChain: A: PDB Molecule:triosephosphate isomerase; PDBTitle: crystal structure of a double mutant (c202a/a198v) of triosephosphate2 isomerase from giardia lamblia
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   159160.........170.........180.........190.........200.....
Predicted Secondary structure 
















Query SS confidence 














































Query Sequence  DNVDAIAATEGVDGIFVGPSDLAAALGHLGNASHPDVQKAIQHIFNR
Query Conservation   
  








 
 

  


  

       
 
  
   
  
Alig confidence 





















...........













Template Conservation   
   
     


 






...........  

  

      
Template Sequence  SNCEKLGQCPNIDGFLVGGASL. . . . . . . . . . . KPEFMTMIDILTKT
Template Known Secondary structure  TTTSTT

SGGGG...........ST
Template Predicted Secondary structure 







...........

Template SS confidence 














































   220.........230.........240. ........250.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions