Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAC4
Confidence2.12%DateThu Jan 5 11:12:32 GMT 2012
Rank26Aligned Residues20
% Identity20%Templated1cf7b_
SCOP infoDNA/RNA-binding 3-helical bundle "Winged helix" DNA-binding domain Cell cycle transcription factor e2f-dp
Resolution2.60

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   184.....190.........200.........210.........220......
Predicted Secondary structure 









Query SS confidence 










































Query Sequence  YDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINLFLML
Query Conservation 



 
                 


  

 









 
Alig confidence 









.......................









Template Conservation   
 






.......................






 
 
Template Sequence  YDQKNIRRRV. . . . . . . . . . . . . . . . . . . . . . . YDALNVLMAM
Template Known Secondary structure  .......................T
Template Predicted Secondary structure 
.......................
Template SS confidence 










































   114.....120... ......130...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions