Return to main results Retrieve Phyre Job Id

Job DescriptionP07118
Confidence23.15%DateThu Jan 5 11:00:14 GMT 2012
Rank145Aligned Residues25
% Identity16%Templatec3nd5D_
PDB info PDB header:transferaseChain: D: PDB Molecule:phosphopantetheine adenylyltransferase; PDBTitle: crystal structure of phosphopantetheine adenylyltransferase (ppat)2 from enterococcus faecalis
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70........
Predicted Secondary structure 










Query SS confidence 































Query Sequence  SLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVG
Query Conservation   





   

 

  

 

 
  

   
Alig confidence 






.......

















Template Conservation 
 
 


....... 
   
    
 
 
 
 
Template Sequence  PMTNGHL. . . . . . . NLIERSAKLFDEVIIGVF
Template Known Secondary structure  T

.......TTSS
Template Predicted Secondary structure 


.......


Template SS confidence 































   13...... 20.........30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions