Return to main results Retrieve Phyre Job Id

Job DescriptionP07118
Confidence20.85%DateThu Jan 5 11:00:14 GMT 2012
Rank150Aligned Residues25
% Identity16%Templatec3f3mA_
PDB info PDB header:transferaseChain: A: PDB Molecule:phosphopantetheine adenylyltransferase; PDBTitle: six crystal structures of two phosphopantetheine2 adenylyltransferases reveal an alternative ligand binding3 mode and an associated structural change
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   47..50.........60.........70........
Predicted Secondary structure 










Query SS confidence 































Query Sequence  SLHMGHAFQQTIMDTMIRYQRMQGKNTLWQVG
Query Conservation   





   

 

  

 

 
  

   
Alig confidence 






.......

















Template Conservation 
 
 


....... 
   
    
 
 
   
Template Sequence  PITYGHL. . . . . . . DIIERSTDRFDEIHVCVL
Template Known Secondary structure  T

.......GGGSS
Template Predicted Secondary structure 


.......


Template SS confidence 































   14.....20 .........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions