Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF76
Confidence8.84%DateThu Jan 5 11:25:29 GMT 2012
Rank21Aligned Residues21
% Identity5%Templatec3muwU_
PDB info PDB header:virusChain: U: PDB Molecule:structural polyprotein; PDBTitle: pseudo-atomic structure of the e2-e1 protein shell in sindbis virus
Resolution9.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   45....50.........60.........70.........80...
Predicted Secondary structure 














Query SS confidence 






































Query Sequence  FTSRQMIIETFICPVSSISNPDEFNTFLLRNQKMMPLSS
Query Conservation    
 



 
 
   
 
 
 
 

   

  
  



Alig confidence 










..................









Template Conservation   

 
  

 
..................







  
Template Sequence  VHGKKIPCTVY. . . . . . . . . . . . . . . . . . DLHLPFKLIP
Template Known Secondary structure  SS



..................
TTTT

Template Predicted Secondary structure 







..................





Template SS confidence 






































   145....150..... ....160.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions