Return to main results Retrieve Phyre Job Id

Job DescriptionP0CF90
Confidence94.91%DateThu Jan 5 11:31:49 GMT 2012
Rank75Aligned Residues50
% Identity22%Templatec3h5tA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulator, laci family; PDBTitle: crystal structure of a transcriptional regulator, lacl2 family protein from corynebacterium glutamicum
Resolution2.53 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50.........60.........70.........80.........
Predicted Secondary structure 






























Query SS confidence 







































































Query Sequence  KNGTGFSEIANILGSKPGTIFTMLRDTGGIKPHERKRAVAHLTLSEREEIRAGLSAKMSIRAIATALNRSPS
Query Conservation    
     

   

       
                  

  

  
  
     
 
 

  

   
Alig confidence 




































......................












Template Conservation   
 


 


   


  






    

  

 
......................
   
  


 
 
Template Sequence  QQYGTLASIAAKLGISRTTVSNAYNRPEQLSAELRQR. . . . . . . . . . . . . . . . . . . . . . ILDTAEDMGYAGA
Template Known Secondary structure 

TTTS

GGGS
......................TT


Template Predicted Secondary structure 














......................




Template SS confidence 







































































   7..10.........20.........30.........40... ......50......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions