Return to main results Retrieve Phyre Job Id

Job DescriptionP00363
Confidence75.97%DateThu Jan 5 10:56:34 GMT 2012
Rank471Aligned Residues33
% Identity12%Templatec3ua4A_
PDB info PDB header:transferaseChain: A: PDB Molecule:protein arginine n-methyltransferase 5; PDBTitle: crystal structure of protein arginine methyltransferase prmt5
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10........ .20....... ..30.........40
Predicted Secondary structure 


.
..........






Query SS confidence 










.








. . . . . . . . . .












Query Sequence  LAIVGAGGAGL. RAAIAAAQA. . . . . . . . . . NPNAKIALISKVY
Query Conservation 






 


. 

  

  ..........
    
 



  
Alig confidence 










.








..........












Template Conservation 
 









  

 
                 








Template Sequence  IYLLGGGRGPIGTKILKSEREYNNTFRQGQESLKVKLYIVEKNP
Template Known Secondary structure  S
TT
STTS




Template Predicted Secondary structure 


















Template SS confidence 











































   410.........420.........430.........440.........450...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions