Return to main results Retrieve Phyre Job Id

Job DescriptionP0ABU2
Confidence96.39%DateThu Jan 5 11:16:24 GMT 2012
Rank301Aligned Residues34
% Identity32%Templatec2cbzA_
PDB info PDB header:transportChain: A: PDB Molecule:multidrug resistance-associated protein 1; PDBTitle: structure of the human multidrug resistance protein 12 nucleotide binding domain 1
Resolution1.5 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40........
Predicted Secondary structure 






















Query SS confidence 












































Query Sequence  KCGIVGLPNVGKSTLFNALTKAGIEAANFPFCTIEPNTGVVPMPD
Query Conservation 





 












     
   




 
  
 
 
 
Alig confidence 





















...........











Template Conservation     
 
 








  
 
 ...........  
  
 
   
Template Sequence  LVAVVGQVGCGKSSLLSALLAE. . . . . . . . . . . MDKVEGHVAIKG
Template Known Secondary structure 
STTSSTT
...........S
S
Template Predicted Secondary structure 






...........











Template SS confidence 












































   673......680.........690.... .....700......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions