Return to main results Retrieve Phyre Job Id

Job DescriptionP28904
Confidence67.11%DateThu Jan 5 11:45:17 GMT 2012
Rank360Aligned Residues41
% Identity17%Templatec3ff4A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of uncharacterized protein chu_1412
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.........60.........70.........80.........90........
Predicted Secondary structure 

































Query SS confidence 

































































Query Sequence  RGVIQHLDYLHKLGVDAIWLTPFYVSPQVDNGYDVANYTAIDPTYGTLDDFDELVTQAKSRGIRII
Query Conservation   

   




 


  
 
 

        

   
   

   

  


 

   
  

 

Alig confidence 


























.........................













Template Conservation        
 
    
 
 
    
   
.........................

     
 

 

Template Sequence  QNQLSEYNYILSLKPKRVIFNPGTENE. . . . . . . . . . . . . . . . . . . . . . . . . ELEEILSENGIEPV
Template Known Secondary structure  GGG

S
TT


.........................TT
Template Predicted Secondary structure 









.........................


Template SS confidence 

































































   66...70.........80.........90.. .......100......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions