Return to main results Retrieve Phyre Job Id

Job DescriptionP28904
Confidence61.66%DateThu Jan 5 11:45:17 GMT 2012
Rank385Aligned Residues41
% Identity15%Templatec2h6rG_
PDB info PDB header:isomeraseChain: G: PDB Molecule:triosephosphate isomerase; PDBTitle: crystal structure of triosephosphate isomerase (tim) from2 methanocaldococcus jannaschii
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   42.......50.........60.........70.........80.........90.........100.
Predicted Secondary structure 

































Query SS confidence 



























































Query Sequence  LHKLGVDAIWLTPFYVSPQVDNGYDVANYTAIDPTYGTLDDFDELVTQAKSRGIRIILDM
Query Conservation 

 


  
 
 

        

   
   

   

  


 

   
  

 



 
Alig confidence 










......






.............






















Template Conservation 
   
   


......





 .............   
    
  
   

  



Template Sequence  IKDCGCKGTLI. . . . . . NHSEKRM. . . . . . . . . . . . . LLADIEAVINKCKNLGLETIVCT
Template Known Secondary structure  T

......SBTTB

.............
T
Template Predicted Secondary structure 



......

.............


Template SS confidence 



























































   78.80........ .90..... ....100.........110........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions