Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADI9
Confidence9.81%DateThu Jan 5 11:21:07 GMT 2012
Rank1Aligned Residues25
% Identity28%Templatec2pm7A_
PDB info PDB header:protein transportChain: A: PDB Molecule:protein transport protein sec31; PDBTitle: crystal structure of yeast sec13/31 edge element of the2 copii vesicular coat, selenomethionine version
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   60.........70.........80.........90...
Predicted Secondary structure 

Query SS confidence 

































Query Sequence  CASLLGDALTLLPRQRLMYAIGAFFLSHLLYTIY
Query Conservation    
  

  
      
  

  





 

 
Alig confidence 







.







........








Template Conservation      

 
.
   
   ........

  


 
Template Sequence  XXIKLGDR. XKENGHRQ. . . . . . . . DSLTLYLAA
Template Known Secondary structure  .TTT
........
Template Predicted Secondary structure  .



........
Template SS confidence 

































   614.....620. ........ 630........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions