Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAG8
Confidence96.91%DateThu Jan 5 11:12:53 GMT 2012
Rank166Aligned Residues26
% Identity42%Templatec2qagB_
PDB info PDB header:cell cycle, structural proteinChain: B: PDB Molecule:septin-6; PDBTitle: crystal structure of human septin trimer 2/6/7
Resolution4.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.
Predicted Secondary structure 












Query SS confidence 































Query Sequence  DNVNLKVRPHSIHALMGENGAGKSTLLKCLFG
Query Conservation    

  
  

   


 








  
 
Alig confidence 






......


















Template Conservation   
    
...... 


  
 






 
 
Template Sequence  SGFCFNI. . . . . . LCVGETGLGKSTLMDTLFN
Template Known Secondary structure 


......
STTSSST
Template Predicted Secondary structure 


......






Template SS confidence 































   38.40.... .....50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions