Return to main results Retrieve Phyre Job Id

Job DescriptionP32057
Confidence87.15%DateThu Jan 5 11:49:04 GMT 2012
Rank94Aligned Residues31
% Identity10%Templatec3sc6F_
PDB info PDB header:oxidoreductaseChain: F: PDB Molecule:dtdp-4-dehydrorhamnose reductase; PDBTitle: 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose2 reductase (rfbd) from bacillus anthracis str. ames in complex with3 nadp
Resolution2.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........
Predicted Secondary structure 












Query SS confidence 






































Query Sequence  MKILVYGINYSPELTGIGKYTGEMVEWLAAQGHEVRVIT
Query Conservation 



 
     
  

       

  
   
  
 

 
Alig confidence 





........
























Template Conservation   




........



 

  
   
   
  
    
Template Sequence  ERVIIT. . . . . . . . GANGQLGKQLQEELNPEEYDIYPFD
Template Known Secondary structure  ........TTTSS
TTT
Template Predicted Secondary structure 
........






Template SS confidence 






































   3..... .10.........20.........30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions