Return to main results Retrieve Phyre Job Id

Job DescriptionP32057
Confidence78.37%DateThu Jan 5 11:49:04 GMT 2012
Rank139Aligned Residues30
% Identity10%Templatec2ydyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:methionine adenosyltransferase 2 subunit beta; PDBTitle: crystal structure of human s-adenosylmethionine synthetase2 2, beta subunit in orthorhombic crystal form
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........
Predicted Secondary structure 











Query SS confidence 





































Query Sequence  KILVYGINYSPELTGIGKYTGEMVEWLAAQGHEVRVIT
Query Conservation 


 
     
  

       

  
   
  
 

 
Alig confidence 




........
























Template Conservation 




........



 

  
   
   
  
    
Template Sequence  RVLVT. . . . . . . . GATGLLGRAVHKEFQQNNWHAVGCG
Template Known Secondary structure  ........TTTSTTT

Template Predicted Secondary structure  ........






Template SS confidence 





































   30.... .....40.........50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions