Return to main results Retrieve Phyre Job Id

Job DescriptionP32057
Confidence52.01%DateThu Jan 5 11:49:04 GMT 2012
Rank290Aligned Residues29
% Identity24%Templatec2rgjA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:flavin-containing monooxygenase; PDBTitle: crystal structure of flavin-containing monooxygenase phzs
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.. ......
Predicted Secondary structure 











.
Query SS confidence 































.





Query Sequence  MKILVYGINYSPELTGIGKYTGEMVEWLAAQG. HEVRVI
Query Conservation 



 
     
  

       

  
   
.  
 

Alig confidence 





.........
















.





Template Conservation   

 

.........


 


  
  

  
   
 
 
Template Sequence  IDILIA. . . . . . . . . GAGIGGLSCALALHQAGIGKVTLL
Template Known Secondary structure 
.........

STT

Template Predicted Secondary structure 
.........






Template SS confidence 






































   5....10 .........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions