Return to main results Retrieve Phyre Job Id

Job DescriptionP32057
Confidence85.51%DateThu Jan 5 11:49:04 GMT 2012
Rank101Aligned Residues33
% Identity24%Templatec2gf2B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:3-hydroxyisobutyrate dehydrogenase; PDBTitle: crystal structure of human hydroxyisobutyrate dehydrogenase
Resolution2.38 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40..
Predicted Secondary structure 















Query SS confidence 









































Query Sequence  MKILVYGINYSPELTGIGKYTGEMVEWLAAQGHEVRVITAPP
Query Conservation 



 
     
  

       

  
   
  
 

    
Alig confidence 





.........


























Template Conservation 


 

.........


 

  

  

  
  
    
  
Template Sequence  MPVGFI. . . . . . . . . GLGNMGNPMAKNLMKHGYPLIIYDVFP
Template Known Secondary structure 

.........

STTTT


SST
Template Predicted Secondary structure 
.........







Template SS confidence 









































   40..... ....50.........60.........70..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions