Return to main results Retrieve Phyre Job Id

Job DescriptionP32057
Confidence64.63%DateThu Jan 5 11:49:04 GMT 2012
Rank215Aligned Residues29
% Identity24%Templatec2cduB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:nadph oxidase; PDBTitle: the crystal structure of water-forming nad(p)h oxidase from2 lactobacillus sanfranciscensis
Resolution1.8 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30. .......
Predicted Secondary structure 










..

Query SS confidence 






























. .






Query Sequence  MKILVYGINYSPELTGIGKYTGEMVEWLAAQ. . GHEVRVI
Query Conservation 



 
     
  

       

  
   ..
  
 

Alig confidence 





.........















..






Template Conservation 





.........


 


 

  
     
  
 

Template Sequence  MKVIVV. . . . . . . . . GCTHAGTFAVKQTIADHPDADVTAY
Template Known Secondary structure 
.........

S
TT
Template Predicted Secondary structure 
.........






Template SS confidence 







































   1..... ...10.........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions