Return to main results Retrieve Phyre Job Id

Job DescriptionP32057
Confidence40.76%DateThu Jan 5 11:49:04 GMT 2012
Rank375Aligned Residues29
% Identity21%Templatec2a87A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:thioredoxin reductase; PDBTitle: crystal structure of m. tuberculosis thioredoxin reductase
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30........
Predicted Secondary structure 
.











Query SS confidence 

.



































Query Sequence  MK. ILVYGINYSPELTGIGKYTGEMVEWLAAQGHEVRVI
Query Conservation 

.

 
     
  

       

  
   
  
 

Alig confidence 

.



.........






















Template Conservation 
 




.........






 

  

  
  
 

Template Sequence  VRDVIVI. . . . . . . . . GSGPAGYTAALYAARAQLAPLVF
Template Known Secondary structure 
.........

TT


Template Predicted Secondary structure 


.........





Template SS confidence 






































   14.....20 .........30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions