Return to main results Retrieve Phyre Job Id

Job DescriptionP32057
Confidence61.40%DateThu Jan 5 11:49:04 GMT 2012
Rank233Aligned Residues32
% Identity19%Templatec1z82A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:glycerol-3-phosphate dehydrogenase; PDBTitle: crystal structure of glycerol-3-phosphate dehydrogenase (tm0378) from2 thermotoga maritima at 2.00 a resolution
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40..
Predicted Secondary structure 














Query SS confidence 








































Query Sequence  KILVYGINYSPELTGIGKYTGEMVEWLAAQGHEVRVITAPP
Query Conservation 


 
     
  

       

  
   
  
 

    
Alig confidence 




......







...


















Template Conservation 

 

......


 

  ... 
  
   
  
    
  
Template Sequence  RFFVL. . . . . . GAGSWGTV. . . FAQXLHENGEEVILWARRK
Template Known Secondary structure  ......

S...TT

SS
Template Predicted Secondary structure  ......


...




Template SS confidence 








































   4.... .10...... ...20.........30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions