Return to main results Retrieve Phyre Job Id

Job DescriptionP32057
Confidence36.55%DateThu Jan 5 11:49:04 GMT 2012
Rank434Aligned Residues29
% Identity28%Templatec1ryiB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:glycine oxidase; PDBTitle: structure of glycine oxidase with bound inhibitor glycolate
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30........
Predicted Secondary structure 
....











Query SS confidence 

. . . .



































Query Sequence  MK. . . . ILVYGINYSPELTGIGKYTGEMVEWLAAQGHEVRVI
Query Conservation 

....

 
     
  

       

  
   
  
 

Alig confidence 

....



.........






















Template Conservation 
    

 

.........



 


 
  

  
  
 

Template Sequence  MKRHYEAVVI. . . . . . . . . GGGIIGSAIAYYLAKENKNTALF
Template Known Secondary structure 

S.........

STT

Template Predicted Secondary structure 


.........




Template SS confidence 









































   1........10 .........20.........30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions