Return to main results Retrieve Phyre Job Id

Job DescriptionP32057
Confidence75.20%DateThu Jan 5 11:49:04 GMT 2012
Rank155Aligned Residues29
% Identity34%Templatec1mv8A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:gdp-mannose 6-dehydrogenase; PDBTitle: 1.55 a crystal structure of a ternary complex of gdp-mannose2 dehydrogenase from psuedomonas aeruginosa
Resolution1.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30........
Predicted Secondary structure 












Query SS confidence 





































Query Sequence  MKILVYGINYSPELTGIGKYTGEMVEWLAAQGHEVRVI
Query Conservation 



 
     
  

       

  
   
  
 

Alig confidence 









.........


















Template Conservation 


 




 .........

  

  

  
  
   
Template Sequence  MRISIFGLGY. . . . . . . . . VGAVCAGCLSARGHEVIGV
Template Known Secondary structure 


ST.........TTT
Template Predicted Secondary structure 


.........


Template SS confidence 





































   1........10 .........20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions