Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence80.05%DateThu Jan 5 11:53:00 GMT 2012
Rank39Aligned Residues29
% Identity7%Templatec3omtA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: putative antitoxin component, chu_2935 protein, from xre family from2 prevotella buccae.
Resolution1.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.....
Predicted Secondary structure 

















Query SS confidence 



































Query Sequence  LRLPAVIQKTGMARATIYDWLNPKSPRYDATFPKKR
Query Conservation 

   
    







           
 

 

Alig confidence 





















.......






Template Conservation 


  

  



   

  
 .......
   
  
Template Sequence  KTNLWLTETLDKNKTTVSKWCT. . . . . . . NDVQPSL
Template Known Secondary structure 

TT

T.......TSS


Template Predicted Secondary structure 




.......



Template SS confidence 



































   1920.........30.........40 .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions