Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence63.95%DateThu Jan 5 11:53:00 GMT 2012
Rank160Aligned Residues28
% Identity14%Templatec3gn5B_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:hth-type transcriptional regulator mqsa (ygit/b3021); PDBTitle: structure of the e. coli protein mqsa (ygit/b3021)
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40....
Predicted Secondary structure 

















Query SS confidence 


































Query Sequence  LRLPAVIQKTGMARATIYDWLNPKSPRYDATFPKK
Query Conservation 

   
    







           
 

 
Alig confidence 





















.......





Template Conservation 


  

  

    



 
 .......
     
Template Sequence  LTQKEASEIFGGGVNAFSRYEK. . . . . . . GNAPHP
Template Known Secondary structure 


S
TT.......T



Template Predicted Secondary structure 





.......




Template SS confidence 


































   83......90.........100.... .....110
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions