Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence59.22%DateThu Jan 5 11:53:00 GMT 2012
Rank199Aligned Residues25
% Identity28%Templatec3fymA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:putative uncharacterized protein; PDBTitle: the 1a structure of ymfm, a putative dna-binding membrane2 protein from staphylococcus aureus
Resolution1.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.
Predicted Secondary structure 














Query SS confidence 































Query Sequence  LRLPAVIQKTGMARATIYDWLNPKSPRYDATF
Query Conservation 

   
    







           
 
Alig confidence 





















.......


Template Conservation 

   

    

   
  

 .......
  
Template Sequence  MTLTELEQRTGIKREMLVHIEN. . . . . . . NEF
Template Known Secondary structure 




T.......T
G
Template Predicted Secondary structure 





.......


Template SS confidence 































   1017..1020.........1030........ .1040.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions