Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence55.10%DateThu Jan 5 11:53:00 GMT 2012
Rank234Aligned Residues22
% Identity9%Templatec3egqB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:tetr family transcriptional regulator; PDBTitle: crystal structure of a tetr-family transcriptional regulator (af_1817)2 from archaeoglobus fulgidus at 2.55 a resolution
Resolution2.55 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40..
Predicted Secondary structure 















Query SS confidence 
































Query Sequence  LRLPAVIQKTGMARATIYDWLNPKSPRYDATFP
Query Conservation 

   
    







           
 

Alig confidence 



















...........

Template Conservation   
   

  



  


  ...........
 
Template Sequence  VSIEEIAREAKVSKSLIFYH. . . . . . . . . . . FE
Template Known Secondary structure 

TS
...........
S
Template Predicted Secondary structure 






...........

Template SS confidence 
































   24.....30.........40... ..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions