Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence64.76%DateThu Jan 5 11:53:00 GMT 2012
Rank149Aligned Residues25
% Identity24%Templatec3bd1B_
PDB info PDB header:transcriptionChain: B: PDB Molecule:cro protein; PDBTitle: structure of the cro protein from putative prophage element xfaso 1 in2 xylella fastidiosa strain ann-1
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40...
Predicted Secondary structure 














Query SS confidence 






























Query Sequence  PAVIQKTGMARATIYDWLNPKSPRYDATFPK
Query Conservation    
    







           
 

 
Alig confidence 



















......




Template Conservation    

  



  

  
   ......  

 
Template Sequence  SALAASLGVRQSAISNWRAR. . . . . . GRVPA
Template Known Secondary structure  T

......T


G
Template Predicted Secondary structure 




......



Template SS confidence 






























   15....20.........30.... .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions