Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence60.29%DateThu Jan 5 11:53:00 GMT 2012
Rank188Aligned Residues21
% Identity29%Templatec2wgbB_
PDB info PDB header:transcriptionChain: B: PDB Molecule:tetr family transcriptional repressor lfrr; PDBTitle: crystal structure of the tetr-like transcriptional2 regulator lfrr from mycobacterium smegmatis
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40..
Predicted Secondary structure 














Query SS confidence 































Query Sequence  RLPAVIQKTGMARATIYDWLNPKSPRYDATFP
Query Conservation 
   
    







           
 

Alig confidence 


















...........

Template Conservation 

  

  



  


  ...........
 
Template Sequence  ALGDIAAAAGVGRSTVHRY. . . . . . . . . . . YP
Template Known Secondary structure 
T

...........
S
Template Predicted Secondary structure 





...........

Template SS confidence 































   33......40.........50. ..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions