Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence76.64%DateThu Jan 5 11:53:00 GMT 2012
Rank53Aligned Residues25
% Identity12%Templatec2r0qF_
PDB info PDB header:recombination/dnaChain: F: PDB Molecule:putative transposon tn552 dna-invertase bin3; PDBTitle: crystal structure of a serine recombinase- dna regulatory2 complex
Resolution3.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........
Predicted Secondary structure 












Query SS confidence 





























Query Sequence  LRLPAVIQKTGMARATIYDWLNPKSPRYDA
Query Conservation 

   
    







           
Alig confidence 






















.....

Template Conservation   
   

  

 
  

 
    ..... 
Template Sequence  QAISKIAKEVNITRQTVYRIKHD. . . . . NG
Template Known Secondary structure 

T

.....

Template Predicted Secondary structure 




.....

Template SS confidence 





























   176...180.........190........ .200
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions