Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence55.48%DateThu Jan 5 11:53:00 GMT 2012
Rank229Aligned Residues22
% Identity27%Templatec2qibA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:tetr-family transcriptional regulator; PDBTitle: crystal structure of tetr-family transcriptional regulator from2 streptomyces coelicolor
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40..
Predicted Secondary structure 















Query SS confidence 
































Query Sequence  LRLPAVIQKTGMARATIYDWLNPKSPRYDATFP
Query Conservation 

   
    







           
 

Alig confidence 



















...........

Template Conservation   

  

  



   

 
...........
 
Template Sequence  VSIDEIASAAGISRPLVYHY. . . . . . . . . . . FP
Template Known Secondary structure 

TS
...........
S
Template Predicted Secondary structure 




...........

Template SS confidence 
































   34.....40.........50... ..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions