Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence82.13%DateThu Jan 5 11:53:00 GMT 2012
Rank31Aligned Residues27
% Identity22%Templatec2kfsA_
PDB info PDB header:dna-binding proteinChain: A: PDB Molecule:conserved hypothetical regulatory protein; PDBTitle: nmr structure of rv2175c
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.
Predicted Secondary structure 















Query SS confidence 
































Query Sequence  ILRLPAVIQKTGMARATIYDWLNPKSPRYDATF
Query Conservation 


   
    







           
 
Alig confidence 






















......



Template Conservation   

  


 




   
     ......   
Template Sequence  TYDLPRVAELLGVPVSKVAQQLR. . . . . . EGHL
Template Known Secondary structure  T

......TTS
Template Predicted Secondary structure 





......


Template SS confidence 
































   2930.........40.........50. ....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions