Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence68.13%DateThu Jan 5 11:53:00 GMT 2012
Rank112Aligned Residues24
% Identity4%Templatec2fjrB_
PDB info PDB header:transcription regulatorChain: B: PDB Molecule:repressor protein ci; PDBTitle: crystal structure of bacteriophage 186
Resolution1.95 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40..
Predicted Secondary structure 













Query SS confidence 





























Query Sequence  PAVIQKTGMARATIYDWLNPKSPRYDATFP
Query Conservation    
    







           
 

Alig confidence 


















......




Template Conservation   


  



  


  
 ......     
Template Sequence  IQLANHFDIASSSLSNRYT. . . . . . RGAIS
Template Known Secondary structure  TTTT

......SSS

Template Predicted Secondary structure 


......




Template SS confidence 





























   27..30.........40..... ....50
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions