Return to main results Retrieve Phyre Job Id

Job DescriptionP33997
Confidence78.13%DateThu Jan 5 11:53:00 GMT 2012
Rank50Aligned Residues36
% Identity31%Templatec2dg6A_
PDB info PDB header:gene regulationChain: A: PDB Molecule:putative transcriptional regulator; PDBTitle: crystal structure of the putative transcriptional regulator sco55502 from streptomyces coelicolor a3(2)
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20.........30.........40.........50.........60.
Predicted Secondary structure 






















Query SS confidence 


















































Query Sequence  RLPAVIQKTGMARATIYDWLNPKSPRYDATFPKKRMLGVKSVGWIEAEIDE
Query Conservation 
   
    







           
 

 




 
 
 
   

  
Alig confidence 





















......





.........







Template Conservation 

 


  








 
   ......


 
 .........
    
 
Template Sequence  RLADLSKRSGVSTATIKYYLRE. . . . . . GLLPPG. . . . . . . . . YDEDHLRR
Template Known Secondary structure 
T

......TSS


.........

Template Predicted Secondary structure 




......





.........

Template SS confidence 


















































   2.......10.........20... ...... 30.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions