Return to main results Retrieve Phyre Job Id

Job DescriptionP0ACW2
Confidence3.34%DateThu Jan 5 11:19:14 GMT 2012
Rank90Aligned Residues27
% Identity15%Templatec3f7xA_
PDB info PDB header:unknown functionChain: A: PDB Molecule:putative polyketide cyclase; PDBTitle: crystal structure of a putative polyketide cyclase (pp0894) from2 pseudomonas putida kt2440 at 1.24 a resolution
Resolution1.24 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   50.........60.........70.........80..
Predicted Secondary structure 











Query SS confidence 
































Query Sequence  GGSLSVARQLDGTAIGMCALPNGKRCSEQSLAA
Query Conservation 

   
     
   
 
 

 
   




 
Alig confidence 






......



















Template Conservation 
      ......        



     
 
Template Sequence  GQTYVLP. . . . . . AGAFFYIHCGKIARVTNYYN
Template Known Secondary structure  S
......TT
Template Predicted Secondary structure 

......



Template SS confidence 
































   97..100... ......110.........120...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions