Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC69
Confidence97.09%DateThu Jan 5 11:17:25 GMT 2012
Rank87Aligned Residues55
% Identity16%Templatec3nivD_
PDB info PDB header:isomeraseChain: D: PDB Molecule:glutathione s-transferase; PDBTitle: the crystal structure of glutathione s-transferase from legionella2 pneumophila
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   17..20.........30.........40.........50.........60.........70.........80.........90..
Predicted Secondary structure 





























Query SS confidence 











































































Query Sequence  ILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQ
Query Conservation 



 

    
 

 
   
  
    
     

         
   

  


 


 
  


 
 
  
  
Alig confidence 





.....

























................






















Template Conservation    

  .....  
    


  
   

 

  
  ................ 



  

  
 

  
  

 
Template Sequence  LILYDY. . . . . FRSTACYRVRIALNLKKIAYEKIEVE. . . . . . . . . . . . . . . . LVPSLDINGQILSQSXAIIDYLE
Template Known Secondary structure 

.....TT
TT




................
SSTT
Template Predicted Secondary structure 



.....








................




Template SS confidence 











































































   1..... ...10.........20.........30.. .......40.........50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions