Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9N0
Confidence4.01%DateThu Jan 5 11:10:46 GMT 2012
Rank94Aligned Residues38
% Identity24%Templatec3e56A_
PDB info PDB header:unknown functionChain: A: PDB Molecule:putative uncharacterized protein; PDBTitle: the 2.0 angstrom resolution crystal structure of npr1517, a putative2 heterocyst differentiation inhibitor from nostoc punctiforme
Resolution2.01 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   30.........40.........50.........60.........70.........80.........
Predicted Secondary structure 























Query SS confidence 



























































Query Sequence  FDAEVLLRNDEGTEAEANSVIALLMLDSAKGRQIEVEATGPQEEEALAAVIALFNSGFDE
Query Conservation    
 
 
    
    




 

 
    
  
 
   
 

  
   
  
    


Alig confidence 








...









...................


















Template Conservation 








...







 
...................




   
 

   



Template Sequence  YECEIHLKF. . . RLIEEKSLLS. . . . . . . . . . . . . . . . . . . DREQLLQVLLDALTEGSDD
Template Known Secondary structure  ...


GGGSS...................


TT
Template Predicted Secondary structure  ......................


Template SS confidence 



























































   18.20...... ...30...... ...40.........50.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions