Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE98
Confidence3.88%DateThu Jan 5 11:22:50 GMT 2012
Rank62Aligned Residues26
% Identity15%Templated1ppjd2
SCOP infoSingle transmembrane helix Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10........ .20......
Predicted Secondary structure 






..........

Query SS confidence 

















. . . . . . . . . .







Query Sequence  MRVKHAVVLLMLISPLSW. . . . . . . . . . AGTMTFQF
Query Conservation     
 
       
  
 ..........
  


 
Alig confidence 

















..........







Template Conservation 

 
 
 
 
 
  
    

 


 







 
Template Sequence  MGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRP
Template Known Secondary structure  T






Template Predicted Secondary structure 







Template SS confidence 



































   204.....210.........220.........230.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions