Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE98
Confidence13.41%DateThu Jan 5 11:22:50 GMT 2012
Rank9Aligned Residues29
% Identity14%Templatec3fcgB_
PDB info PDB header:membrane protein, protein transportChain: B: PDB Molecule:f1 capsule-anchoring protein; PDBTitle: crystal structure analysis of the middle domain of the2 caf1a usher
Resolution2.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   92.......100.........110.........120.........
Predicted Secondary structure 












Query SS confidence 





































Query Sequence  PGRMVTNDYIVDIANRDGQLQLNVTDRKTGQTSTIQVS
Query Conservation   

  


  
 
    
 
 
 


  


 
 
 
 
Alig confidence 








........








.










Template Conservation 



 
 

........
 
 
 
 
.  
      

Template Sequence  SGPFELANL. . . . . . . . PELKVIIHE. SDGTKQVFTVP
Template Known Secondary structure  S
S
........


.TTS

Template Predicted Secondary structure 





........
.



Template SS confidence 





































   275....280... ......290.. .......300...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions