Return to main results Retrieve Phyre Job Id

Job DescriptionP0AE98
Confidence3.89%DateThu Jan 5 11:22:50 GMT 2012
Rank61Aligned Residues42
% Identity17%Templatec2jp2A_
PDB info PDB header:signaling proteinChain: A: PDB Molecule:sprouty-related, evh1 domain-containing protein PDBTitle: solution structure and resonance assignment of the n-2 terminal evh1 domain from the human spred2 protein3 (sprouty-related protein with evh1 domain isoform 2)
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   21........30.........40.........50.........60.........70.........
Predicted Secondary structure 





























Query SS confidence 


























































Query Sequence  TMTFQFRNPNFGGNPNNGAFLLNSAQAQNSYKDPSYNDDFGIETPSALDNFTQAIQSQI
Query Conservation   


 









 

  

  




   

           



 
  

 
 
Alig confidence 











.................





























Template Conservation   
 
      

................. 
       

 
   
 
  
   
  

Template Sequence  DLVYTKANPTFH. . . . . . . . . . . . . . . . . HWKVDNRKFGLTFQSPADARAFDRGVRKAI
Template Known Secondary structure 


TT.................
SSSSS
Template Predicted Secondary structure 




.................



Template SS confidence 


























































   80.........90. ........100.........110.........120.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions