Return to main results Retrieve Phyre Job Id

Job DescriptionP45468
Confidence2.05%DateThu Jan 5 12:02:44 GMT 2012
Rank86Aligned Residues50
% Identity14%Templatec1k3rA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:conserved protein mt0001; PDBTitle: crystal structure of the methyltransferase with a knot from2 methanobacterium thermoautotrophicum
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3940.........50.........60.........70.........80.........90.........100.... ....
Predicted Secondary structure 













.



Query SS confidence 

































































.



Query Sequence  GKAFTAAETHSIGKSILAQADANPWQAALDYAMIYFLAVWKAAVLGVILGSLIQVLIPRDWLLRTL. GQSR
Query Conservation   
                                    

  



 





  


   
 
 
.
   
Alig confidence 


























....................


















.



Template Conservation 









 








       .................... 
  

 









 


   
Template Sequence  VLIARAASIFGVKRIVIYHDDADGEAR. . . . . . . . . . . . . . . . . . . . FIRDILTYMDTPQYLRRKVFPIMR
Template Known Secondary structure  TT


SS


....................S




G
Template Predicted Secondary structure 









....................







Template SS confidence 






































































   2930.........40.........50..... ....60.........70.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions