Return to main results Retrieve Phyre Job Id

Job DescriptionP45570
Confidence1.43%DateThu Jan 5 12:03:21 GMT 2012
Rank56Aligned Residues27
% Identity30%Templatec2pmpA_
PDB info PDB header:lyaseChain: A: PDB Molecule:2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase; PDBTitle: structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from2 the isoprenoid biosynthetic pathway of arabidopsis thaliana
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.
Predicted Secondary structure 








Query SS confidence 





































Query Sequence  VITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDAD
Query Conservation   


 
 
  
  
           
   
 
 




Alig confidence 

















...........








Template Conservation 





 





  


...........

  




Template Sequence  VLLHCVVDAILGALGLPD. . . . . . . . . . . IGQIFPDSD
Template Known Secondary structure  T


...........S
SS
Template Predicted Secondary structure 




...........








Template SS confidence 





































   42.......50......... 60........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions