Return to main results Retrieve Phyre Job Id

Job DescriptionP42628
Confidence3.65%DateThu Jan 5 12:01:58 GMT 2012
Rank45Aligned Residues29
% Identity24%Templatec2kb1A_
PDB info PDB header:membrane proteinChain: A: PDB Molecule:wsk3; PDBTitle: nmr studies of a channel protein without membrane:2 structure and dynamics of water-solubilized kcsa
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   10.........20.........30.........40.........50.........
Predicted Secondary structure 




















Query SS confidence 

















































Query Sequence  IADASTPAGRAGMSESEWREAIKFDSTDTGWVIMSIGMAIGAGIVFLPVQ
Query Conservation        
                           
  
 

 


 

  
Alig confidence 









.....................


















Template Conservation 

 
 
  

.....................
      
 

   
    
Template Sequence  DRYPVTEEGR. . . . . . . . . . . . . . . . . . . . . KVAEQVMKAGIEVFALVTA
Template Known Secondary structure  SS


STTTT.....................T
Template Predicted Secondary structure 


.....................
Template SS confidence 

















































   5960........ .70.........80.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions